Did I find the right examples for you? yes no      Crawl my project      Python Jobs

All Samples(2)  |  Call(2)  |  Derive(0)  |  Import(0)
A human readable summary of the record and its annotation (string).

The python built in function str works by calling the object's ___str__
method.  e.g.

>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> from Bio.Alphabet import IUPAC
>>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF",
...                         IUPAC.protein),(more...)

src/p/y/python-dna-0.1.2/pydna/dsdna.py   python-dna(Download)
    def __str__(self):
        return ("Drecord\n"
                 "circular: {}\n"
                 "size: {}\n").format(self.circular, len(self))+SeqRecord.__str__(self)
 

src/p/y/pydna-0.6.1/pydna/dsdna.py   pydna(Download)
    def __str__(self):
        return ("Dseqrecord\n"
                 "circular: {}\n"
                 "size: {}\n").format(self.circular, len(self))+SeqRecord.__str__(self)