#!/usr/bin/env python """Unit tests for the GenBank database parsers. """ from cogent.parse.genbank import parse_locus, parse_single_line, \ indent_splitter, parse_sequence, block_consolidator, parse_organism, \ parse_feature, location_line_tokenizer, parse_simple_location_segment, \ parse_location_line, parse_reference, parse_source, \ Location, LocationList from cogent.util.unit_test import TestCase, main __author__ = "Rob Knight" __copyright__ = "Copyright 2007-2012, The Cogent Project" __credits__ = ["Rob Knight", "Gavin Huttley"] __license__ = "GPL" __version__ = "1.5.3" __maintainer__ = "Rob Knight" __email__ = "rob@spot.colorado.edu" __status__ = "Production" class GenBankTests(TestCase): """Tests of the GenBank main functions.""" def test_parse_locus(self): """parse_locus should give correct results on specimen locus lines""" line = 'LOCUS AF108830 5313 bp mRNA linear PRI 19-MAY-1999' result = parse_locus(line) self.assertEqual(len(result), 6) self.assertEqual(result['locus'], 'AF108830') self.assertEqual(result['length'], 5313) #note: int, not str self.assertEqual(result['mol_type'], 'mRNA') self.assertEqual(result['topology'], 'linear') self.assertEqual(result['db'], 'PRI') self.assertEqual(result['date'], '19-MAY-1999') #should work if some of the fields are missing line = 'LOCUS AF108830 5313' result = parse_locus(line) self.assertEqual(len(result), 2) self.assertEqual(result['locus'], 'AF108830') self.assertEqual(result['length'], 5313) #note: int, not str def test_parse_single_line(self): """parse_single_line should split off the label and return the rest""" line_1 = 'VERSION AF108830.1 GI:4868112\n' self.assertEqual(parse_single_line(line_1), 'AF108830.1 GI:4868112') #should work if leading spaces line_2 = ' VERSION AF108830.1 GI:4868112\n' self.assertEqual(parse_single_line(line_2), 'AF108830.1 GI:4868112') def test_indent_splitter(self): """indent_splitter should split lines at correct locations""" #if lines have same indent, should not group together lines = [ 'abc xxx', 'def yyy' ] self.assertEqual(list(indent_splitter(lines)),\ [[lines[0]], [lines[1]]]) #if second line is indented, should group with first lines = [ 'abc xxx', ' def yyy' ] self.assertEqual(list(indent_splitter(lines)),\ [[lines[0], lines[1]]]) #if both lines indented but second is more, should group with first lines = [ ' abc xxx', ' def yyy' ] self.assertEqual(list(indent_splitter(lines)),\ [[lines[0], lines[1]]]) #if both lines indented equally, should not group lines = [ ' abc xxx', ' def yyy' ] self.assertEqual(list(indent_splitter(lines)), \ [[lines[0]], [lines[1]]]) #for more complex situation, should produce correct grouping lines = [ ' xyz', #0 - ' xxx', #1 - ' yyy', #2 ' uuu', #3 ' iii', #4 ' qaz', #5 - ' wsx', #6 - ' az', #7 ' sx', #8 ' gb',#9 ' bg', #10 ' aaa', #11 - ] self.assertEqual(list(indent_splitter(lines)), \ [[lines[0]], lines[1:5], [lines[5]], lines[6:11], [lines[11]]]) #real example from genbank file lines = \ """LOCUS NT_016354 92123751 bp DNA linear CON 29-AUG-2006 DEFINITION Homo sapiens chromosome 4 genomic contig, reference assembly. ACCESSION NT_016354 NT_006109 NT_006204 NT_006245 NT_006302 NT_006371 NT_006397 NT_016393 NT_016589 NT_016599 NT_016606 NT_022752 NT_022753 NT_022755 NT_022760 NT_022774 NT_022797 NT_022803 NT_022846 NT_022960 NT_025694 NT_028147 NT_029273 NT_030643 NT_030646 NT_030662 NT_031780 NT_031781 NT_031791 NT_034703 NT_034705 NT_037628 NT_037629 NT_079512 VERSION NT_016354.18 GI:88977422 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. ? REFERENCE 2 (bases 1 to 92123751) AUTHORS International Human Genome Sequencing Consortium. TITLE Finishing the euchromatic sequence of the human genome""".split('\n') self.assertEqual(list(indent_splitter(lines)), \ [[lines[0]],[lines[1]],lines[2:8],[lines[8]],[lines[9]],lines[10:15],\ [lines[15]], lines[16:]]) def test_parse_sequence(self): """parse_sequence should strip bad chars out of sequence lines""" lines = """ ORIGIN 1 gggagcgcgg cgcgggagcc cgaggctgag actcaccgga ggaagcggcg cgagcgcccc 61 gccatcgtcc \t\t cggctgaagt 123 \ngcagtg \n 121 cctgggctta agcagtcttc45ccacctcagc //\n\n\n""".split('\n') result = parse_sequence(lines) self.assertEqual(result, 'gggagcgcggcgcgggagcccgaggctgagactcaccggaggaagcggcgcgagcgccccgccatcgtcccggctgaagtgcagtgcctgggcttaagcagtcttcccacctcagc') def test_block_consolidator(self): """block_consolidator should join the block together.""" lines = """ ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo.""".split('\n') label, data = block_consolidator(lines) self.assertEqual(label, 'ORGANISM') self.assertEqual(data, ['Homo sapiens', ' Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;', ' Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;', ' Hominidae; Homo.']) lines = r"""COMMENT Contact: Spindel ER Division of Neuroscience""".splitlines() label, data = block_consolidator(lines) self.assertEqual(label, "COMMENT") self.assertEqual(data, ['', ' Contact: Spindel ER', ' Division of Neuroscience']) def test_parse_organism(self): """parse_organism should return species, taxonomy (up to genus)""" #note: lines modified to include the following: # - multiword names # - multiword names split over a line break # - periods and other punctuation in names lines = """ ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates \t abc. 2.; Catarrhini Hominidae; Homo.""".split('\n') species, taxonomy = parse_organism(lines) self.assertEqual(species, 'Homo sapiens') self.assertEqual(taxonomy, ['Eukaryota', 'Metazoa', \ 'Chordata Craniata', 'Vertebrata', 'Euteleostomi', 'Mammalia', \ 'Eutheria', 'Euarchontoglires', 'Primates abc. 2.', \ 'Catarrhini Hominidae', 'Homo']) def test_parse_feature(self): """parse_feature should return dict containing annotations of feature""" example_feature=\ """ CDS complement(join(102262..102647,105026..105217, 106638..106719,152424..152682,243209..243267)) /gene="nad1" /note="Protein sequence is in conflict with the conceptual translation; author given translation (not conceptual translation) start codon is created by C to U RNA editing" /codon_start=1 /exception="RNA editing" /product="NADH dehydrogenase subunit 1" /protein_id="NP_064011.1" /db_xref="GI:9838451" /db_xref="IPI:12345" /translation="MYIAVPAEILGIILPLLLGVAFLVLAERKVMAFVQRRKGPDVVG SFGLLQPLADGSKLILKEPISPSSANFSLFRMAPVTTFMLSLVARAVVPFDYGMVLSD PNIGLLYLFAISSLGVYGIIIAGWSSNSKYAFLGALRSAAQMVPYEVSIGLILITVLI CVGPRNSSEIVMAQKQIWSGIPLFPVLVMFFISCLAETNRAPFDLPEAERELVAGYNV EYSSMGSALFFLGEYANMILMSGLCTSLSPGGWPPILDLPISKRIPGSIWFSIKVILF LFLYIWVRAAFPRYRYDQLMGLGRKVFLPLSLARVVAVSGVLVTFQWLP""" result = parse_feature(example_feature.split('\n')) self.assertEqual(result['type'], 'CDS') self.assertEqual(result['raw_location'], \ ['complement(join(102262..102647,105026..105217,', \ ' 106638..106719,152424..152682,243209..243267))']) self.assertEqual(result['gene'], ['nad1']) self.assertEqual(result['note'], ['Protein sequence is in conflict with the conceptual translation; author given translation (not conceptual translation) start codon is created by C to U RNA editing']) self.assertEqual(result['codon_start'], ['1']) self.assertEqual(result['exception'], ['RNA editing']) self.assertEqual(result['product'], ['NADH dehydrogenase subunit 1']) self.assertEqual(result['protein_id'],['NP_064011.1']) self.assertEqual(result['db_xref'], ['GI:9838451','IPI:12345']) self.assertEqual(result['translation'],['MYIAVPAEILGIILPLLLGVAFLVLAERKVMAFVQRRKGPDVVGSFGLLQPLADGSKLILKEPISPSSANFSLFRMAPVTTFMLSLVARAVVPFDYGMVLSDPNIGLLYLFAISSLGVYGIIIAGWSSNSKYAFLGALRSAAQMVPYEVSIGLILITVLICVGPRNSSEIVMAQKQIWSGIPLFPVLVMFFISCLAETNRAPFDLPEAERELVAGYNVEYSSMGSALFFLGEYANMILMSGLCTSLSPGGWPPILDLPISKRIPGSIWFSIKVILFLFLYIWVRAAFPRYRYDQLMGLGRKVFLPLSLARVVAVSGVLVTFQWLP']) self.assertEqual(len(result), 11) short_feature = ['D-loop 15418..16866'] result = parse_feature(short_feature) self.assertEqual(result['type'], 'D-loop') self.assertEqual(result['raw_location'], ['15418..16866']) #can get more than one = in a line #from AF260826 bad_feature = \ """ tRNA 1173..1238 /note="codon recognized: AUC; Cove score = 16.56" /product="tRNA-Ile" /anticodon=(pos:1203..1205,aa:Ile)""" result = parse_feature(bad_feature.split('\n')) self.assertEqual(result['note'], \ ['codon recognized: AUC; Cove score = 16.56']) #need not always have an = in a line #from NC_001807 bad_feature = \ ''' mRNA 556 /partial /citation=[6] /product="H-strand"''' result = parse_feature(bad_feature.split('\n')) self.assertEqual(result['partial'], ['']) def test_location_line_tokenizer(self): """location_line_tokenizer should tokenize location lines""" llt =location_line_tokenizer self.assertEqual(list(llt(['123..456'])), ['123..456']) self.assertEqual(list(llt(['complement(123..456)'])), \ ['complement(', '123..456', ')']) self.assertEqual(list(llt(['join(1..2,3..4)'])), \ ['join(', '1..2', ',', '3..4', ')']) self.assertEqual(list(llt([\ 'join(complement(1..2, join(complement( 3..4),',\ '\n5..6), 7..8\t))'])),\ ['join(','complement(','1..2',',','join(','complement(','3..4',\ ')', ',', '5..6',')',',','7..8',')',')']) def test_parse_simple_location_segment(self): """parse_simple_location_segment should parse simple segments""" lsp = parse_simple_location_segment l = lsp('37') self.assertEqual(l._data, 37) self.assertEqual(str(l), '37') self.assertEqual(l.Strand, 1) l = lsp('40..50') first, second = l._data self.assertEqual(first._data, 40) self.assertEqual(second._data, 50) self.assertEqual(str(l), '40..50') self.assertEqual(l.Strand, 1) #should handle ambiguous starts and ends l = lsp('>37') self.assertEqual(l._data, 37) self.assertEqual(str(l), '>37') l = lsp('<37') self.assertEqual(l._data, 37) self.assertEqual(str(l), '<37') l = lsp('<37..>42') first, second = l._data self.assertEqual(first._data, 37) self.assertEqual(second._data, 42) self.assertEqual(str(first), '<37') self.assertEqual(str(second), '>42') self.assertEqual(str(l), '<37..>42') def test_parse_location_line(self): """parse_location_line should give correct list of location objects""" llt = location_line_tokenizer r = parse_location_line(llt(['123..456'])) self.assertEqual(str(r), '123..456') r = parse_location_line(llt(['complement(123..456)'])) self.assertEqual(str(r), 'complement(123..456)') r = parse_location_line(llt(['complement(123..456, 345..678)'])) self.assertEqual(str(r), \ 'join(complement(345..678),complement(123..456))') r = parse_location_line(llt(['complement(join(123..456, 345..678))'])) self.assertEqual(str(r), \ 'join(complement(345..678),complement(123..456))') r = parse_location_line(\ llt(['join(complement(123..456), complement(345..678))'])) self.assertEqual(str(r), \ 'join(complement(123..456),complement(345..678))') #try some nested joins and complements r = parse_location_line(llt(\ ['complement(join(1..2,3..4,complement(5..6),', 'join(7..8,complement(9..10))))'])) self.assertEqual(str(r), \ 'join(9..10,complement(7..8),5..6,complement(3..4),complement(1..2))') def test_parse_reference(self): """parse_reference should give correct fields""" r = \ """REFERENCE 2 (bases 1 to 2587) AUTHORS Janzen,D.M. and Geballe,A.P. TITLE The effect of eukaryotic release factor depletion on translation termination in human cell lines JOURNAL (er) Nucleic Acids Res. 32 (15), 4491-4502 (2004) PUBMED 15326224""" result = parse_reference(r.split('\n')) self.assertEqual(len(result), 5) self.assertEqual(result['reference'], '2 (bases 1 to 2587)') self.assertEqual(result['authors'], 'Janzen,D.M. and Geballe,A.P.') self.assertEqual(result['title'], \ 'The effect of eukaryotic release factor depletion ' + \ 'on translation termination in human cell lines') self.assertEqual(result['journal'], \ '(er) Nucleic Acids Res. 32 (15), 4491-4502 (2004)') self.assertEqual(result['pubmed'], '15326224') def test_parse_source(self): """parse_source should split into source and organism""" s = \ """SOURCE African elephant. ORGANISM Mitochondrion Loxodonta africana Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Proboscidea; Elephantidae; Loxodonta.""".split('\n') r = parse_source(s) self.assertEqual(len(r), 3) self.assertEqual(r['source'], 'African elephant.') self.assertEqual(r['species'], 'Mitochondrion Loxodonta africana') self.assertEqual(r['taxonomy'], ['Eukaryota','Metazoa', 'Chordata',\ 'Craniata', 'Vertebrata', 'Euteleostomi', 'Mammalia',\ 'Eutheria', 'Proboscidea', 'Elephantidae', 'Loxodonta']) class LocationTests(TestCase): """Tests of the Location class.""" def test_init(self): """Location should init with 1 or 2 values, plus params.""" l = Location(37) self.assertEqual(str(l), '37') l = Location(37, Ambiguity = '>') self.assertEqual(str(l), '>37') l = Location(37, Ambiguity='<') self.assertEqual(str(l), '<37') l = Location(37, Accession='AB123') self.assertEqual(str(l), 'AB123:37') l = Location(37, Accession='AB123', Db='Kegg') self.assertEqual(str(l), 'Kegg::AB123:37') l1 = Location(37) l2 = Location(42) l = Location([l1,l2]) self.assertEqual(str(l), '37..42') l3 = Location([l1,l2], IsBounds=True) self.assertEqual(str(l3), '(37.42)') l4 = Location([l1,l2], IsBetween=True) self.assertEqual(str(l4), '37^42') l5 = Location([l4,l3]) self.assertEqual(str(l5), '37^42..(37.42)') l5 = Location([l4,l3], Strand=-1) self.assertEqual(str(l5), 'complement(37^42..(37.42))') class LocationListTests(TestCase): """Tests of the LocationList class.""" def test_extract(self): """LocationList extract should return correct sequence""" l = Location(3) l2_a = Location(5) l2_b = Location(7) l2 = Location([l2_a,l2_b], Strand=-1) l3_a = Location(10) l3_b = Location(12) l3 = Location([l3_a, l3_b]) ll = LocationList([l, l2, l3]) s = ll.extract('ACGTGCAGTCAGTAGCAT') # 123456789012345678 self.assertEqual(s, 'G'+'TGC'+'CAG') #check a case where it wraps around l5_a = Location(16) l5_b = Location(4) l5 = Location([l5_a,l5_b]) ll = LocationList([l5]) s = ll.extract('ACGTGCAGTCAGTAGCAT') self.assertEqual(s, 'CATACGT') if __name__ == '__main__': from sys import argv if len(argv) > 2 and argv[1] == 'x': filename = argv[2] lines = open(filename) for i in indent_splitter(lines): print '******' print i[0] for j in indent_splitter(i[1:]): print '?????' for line in j: print line else: main()